PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g091830.2
Common NameMTR_8g091830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 759aa    MW: 83771.3 Da    PI: 4.5167
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g091830.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.71.7e-10601644146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+W+t + e++++a++q+G++ ++ I + ++  +t+ q+k+++ k
  Medtr8g091830.2 601 RGKWSTRDTEKFYEAIRQFGTD-FTMIQQLFP-DKTRHQIKLKYKK 644
                      89********************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159635.4E-27594679No hitNo description
Gene3DG3DSA:1.10.10.604.7E-6597644IPR009057Homeodomain-like
PROSITE profilePS512939.781599647IPR017884SANT domain
SMARTSM007172.7E-8600648IPR001005SANT/Myb domain
SuperFamilySSF466892.84E-10602650IPR009057Homeodomain-like
CDDcd001672.02E-6603644No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 759 aa     Download sequence    Send to blast
MDDLFDDIVP TTTTTTRARG RFAPKAKPKP PPPQKNNVSA STTHEESQLI SPKNDSHNAD  60
INVNNAQSVH PANAVENVLN NAAAVSTTDS TIGSNKELPT NGEGSFLDSN KSLEVIDNSL  120
EVSLNAGFKS ASGDINNGIS ESDLHSSFEF GEVREVLSAE IELDPFSDVL PDPGTGKAKK  180
FQPKIKPRPR VSNTPATASA SSGIPFSEDD RSLEAVIPSH SDSLNAMPSE SAVHDGTRDF  240
PSSFGKSVAE NADIFSGLES LDDILNQDAT GTAKPDLKSF NVNGAEEKFV LPGYDGKSRS  300
EIQEGADLNP DPDCPIDNVY DDYQSMKSGI DPTSEIPRHE GLTNSPDSPT LADLLQQDDA  360
GEKEVANERK KSLKKHKISS IAGVEDKGGK SSRKPRKQAA SKPTKNSLNE AVNGDDVLDP  420
PYVIDGDELE ENDDDDDVDY SSKKTSASTS SKKKSVAKKG KTSKKRKKAN DDSEKVTEEP  480
PKKFPHASRR RKRCVDKALL ENDYLDQRTI PIRDIILIAE HKERLAKKEA TPSQTPSTNQ  540
SDGDFHHDVD FHHEADANYE EEFFGSDDEF RDLDDDDRAT EKITSTTPLL NYQSFMDKAP  600
RGKWSTRDTE KFYEAIRQFG TDFTMIQQLF PDKTRHQIKL KYKKEERQHP LLLTDAMNNR  660
GKDLSFFKLV VEKQKQNSNK EEDTAEDASD LMIGEGEENE DPTPGTKEEV ATAEQEQDHI  720
NVKDQEDSMA YPVPEQSDDS DDGLQNNEDA WYHYQSAI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1451467KKKSVAKKGKTSKKRKK
2463467KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1674040.0AC167404.11 Medicago truncatula clone mth2-9d11, complete sequence.
GenBankAC2024850.0AC202485.8 Medicago truncatula clone mth2-176b2, complete sequence.
GenBankAC2035410.0AC203541.4 Medicago truncatula clone mth2-20k1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013446844.10.0myb-like DNA-binding domain protein
TrEMBLA0A072TUQ30.0A0A072TUQ3_MEDTR; Myb-like DNA-binding domain protein
STRINGGLYMA11G01285.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.12e-37MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]